Slow Cooker Honey Mustard Chicken Recipe
30-MINUTE MEALS! Get the email series now
Royal Recipe

Slow Cooker Honey Mustard Chicken

5 from 1 vote
1 Comments
Victoria
By: VictoriaUpdated: May 19, 2026
This post may contain affiliate links. Please read our disclosure policy.

Tender, fall-apart chicken simmered in a glossy honey mustard glaze, perfect for easy weeknights and make-ahead meals.

Slow Cooker Honey Mustard Chicken

This slow cooker honey mustard chicken is one of those dishes I turn to when I want comforting, hands-off cooking that still tastes like I spent hours in the kitchen. I discovered this combination on a rainy Sunday when I needed a simple dinner that would please picky eaters and adults alike. The balance of sweet honey and bright mustard creates a sticky, savory-sweet glaze that clings to the meat, while the slow, gentle heat makes the chicken unbelievably tender. The first time I served it, my family circled the table and went back for seconds, and ever since it has been a reliable option for busy evenings.

I love how minimal the ingredient list is, yet how layered the finished dish tastes. The texture of the sauce becomes glossy and almost jam like after thickening, coating each piece of chicken in a flavorful sheen. This version works whether you use all breasts, all thighs, or a mix of both. Thighs give a richer mouthfeel while breasts are leaner and still absorb the sauce beautifully. There is comfort in its simplicity, and I often find myself preparing a double batch to have leftovers for wraps or salads the next day.

Why You'll Love This Recipe

  • Hands off cooking: set the slow cooker and let the oven of gentle heat do the work, freeing you to handle the rest of your day.
  • Minimal, pantry friendly ingredients: Dijon, stone ground mustard, honey, garlic, salt and pepper create a deep, balanced glaze.
  • Flexible protein: works with boneless, skinless breasts, thighs, or a mix to suit preference and budget.
  • Make ahead friendly: can be marinated or assembled in advance then cooked later for easy entertaining.
  • Quick finishing: a simple potato starch slurry thickens the sauce to a glossy finish in seconds before serving.

In my experience this dish reliably pleases a crowd. I once brought a slow cooker of this to a small potluck and it disappeared faster than anything else on the table. The simple flavors feel familiar but the texture and finish make it feel special. My kids, who can be picky, always ask for this when it is on the menu, and I love that it reheats well for lunches the next day.

Ingredients

  • Chicken: Use 2 boneless, skinless chicken breasts plus 4 boneless chicken thighs as written, or substitute with four to six breasts or six to eight thighs depending on appetite. Thighs stay juicier; breasts are lean and will still absorb the sauce well. Choose fresh or thawed poultry from a trusted brand for best texture.
  • Dijon mustard: One third cup provides tang and body. I prefer a good quality Dijon such as Maille or Grey Poupon for a clean, sharp flavor that balances the honey.
  • Stone ground mustard: One third cup adds texture and nutty mustard seeds. This gives visual interest and a more rustic mustard profile than smooth mustard alone.
  • Honey: One half cup supplies sweetness and helps the sauce caramelize slightly at the end. Use a mild clover honey for balanced sweetness, or a darker honey for a deeper flavor.
  • Garlic: One tablespoon minced garlic brightens the sauce. Fresh minced garlic is best, but jarred minced garlic will work in a pinch.
  • Salt and black pepper: One half teaspoon each seasons the mixture. Adjust to taste after cooking when the sauce concentrates.
  • Optional thickener: Two tablespoons potato starch mixed with four tablespoons cold water creates a slurry that thickens the sauce into a glossy glaze just before serving. Cornstarch works as a substitute in the same ratio if you prefer.

Instructions

Prepare the slow cooker: Lightly coat the base and sides of the slow cooker with a non stick spray or a tablespoon of neutral oil to make cleanup simple. Ensure the unit is clean and the insert fits snugly. For a crispier finish later, you can finish the chicken under a hot broiler for two to three minutes after thickening the sauce. Mix the sauce: In the slow cooker pot combine one third cup Dijon mustard, one third cup stone ground mustard, one half cup honey, one tablespoon minced garlic, one half teaspoon salt and one half teaspoon ground black pepper. Stir until glossy and evenly emulsified. Taste to check the balance and adjust salt if necessary; the slow cook will mellow the sharpness slightly. Add the chicken: Arrange the chicken breasts and thighs in the mustard mixture so each piece sits in the sauce. Gently toss with tongs or a spoon to coat, taking care not to tear the meat. Nestling the pieces ensures even cooking and maximum flavor absorption. Optional marinating: If time allows, transfer the coated chicken and sauce to a zip top bag and refrigerate for a few hours or overnight. Marinating concentrates flavor and allows the mustard and honey to penetrate the meat. Bring to near room temperature before placing in the slow cooker. Cook the chicken: Set the slow cooker on low and cook for four to six hours, or set on high for two and a half to three hours. The chicken is done when an instant read thermometer registers one hundred sixty five degrees Fahrenheit in the thickest part, or when the meat is fork tender and pulls apart easily. Thicken the sauce: About five minutes before serving mix two tablespoons potato starch with four tablespoons cold water to make a smooth slurry. Stir the slurry into the warm sauce in the slow cooker, and allow it to thicken for two to three minutes until glossy. Taste and adjust seasoning with a pinch more salt or a squeeze of lemon if desired. Serve: Spoon the thickened sauce over the chicken and transfer to a warmed serving platter. Garnish with chopped parsley if you like. Serve with rice, mashed potatoes, or a green salad to balance the sweet glaze. User provided content image 1

You Must Know

  • This dish is high in protein and moderate in fat; each serving reheats well and keeps in the refrigerator for three to four days.
  • The sauce freezes well for up to three months if stored in an airtight container; thaw overnight in the refrigerator before reheating.
  • Use potato starch or cornstarch for a glossy finish; adding the slurry slowly prevents lumps and over thickening.
  • Mustard contains natural enzymes that mellow with slow cooking, so the final sauce will taste sweeter and less sharp than when raw.

I treasure the simplicity of this dish. One memorable evening I arrived home after a long commute to the smell of honey and mustard, and everyone sat down together without fuss. It feels like a small luxury to serve something that tastes elevated yet required very little active time. Leftovers transformed into sandwiches and grain bowls felt just as special midweek.

Storage Tips

Store cooled chicken and sauce in airtight containers in the refrigerator for up to four days. For longer storage, portion into freezer safe containers and freeze for up to three months. To reheat, thaw overnight in the refrigerator then warm gently in a saucepan over low heat, stirring occasionally until heated through. If sauce separates, whisk in a teaspoon of water or a small knob of butter to bring it back together. Avoid reheating in a microwave for extended times to prevent drying the meat; a gentle stovetop or oven method preserves texture.

Ingredient Substitutions

If you do not have stone ground mustard, substitute with an additional one third cup Dijon mustard plus one teaspoon whole grain mustard seeds for texture. Use maple syrup instead of honey for a different sweetness profile. If you need a gluten free thickener, potato starch or cornstarch are both suitable in the same proportions. For a lower sugar option, reduce honey to one third cup and add a tablespoon of apple cider vinegar to retain brightness. For a dairy enriched finish, stir in one tablespoon unsalted butter at the end for sheen and mouthfeel.

User provided content image 2

Serving Suggestions

Serve the chicken over steamed white rice or buttery mashed potatoes so the sauce can be spooned liberally. For a lighter plate, pair with a crisp green salad dressed in a simple vinaigrette to cut the richness. Roasted seasonal vegetables such as carrots or Brussels sprouts add texture contrast. For family style dinners, place the slow cooker on the table for guests to help themselves. Garnish with chopped parsley or sliced green onions for color and a fresh flavor lift.

Cultural Background

The combination of honey and mustard has roots in European culinary traditions where mustard provides piquancy and honey balances it with sweetness. This pairing evolved into many classic sauces and glazes used on poultry. Slow cooking as a technique has long been used to transform humble cuts into tender meals. This version nods to comfort food traditions in American kitchens, where convenience and bold, familiar flavors meet.

Seasonal Adaptations

In spring and summer lighten the sauce with the addition of chopped fresh herbs such as tarragon or dill just before serving. In autumn pair with roasted root vegetables and swap honey for a darker varietal like buckwheat for a deeper flavor. During winter, add a pinch of smoked paprika for warmth or stir in a tablespoon of cider vinegar to brighten the heavier flavors. These small adjustments help the dish feel at home in any season.

Meal Prep Tips

Assemble the sauce and chicken in a zip top bag for make ahead convenience. Label with the cook day and either refrigerate for a few hours or freeze. When ready, thaw if frozen, then transfer to the slow cooker and cook as directed. Portion into individual containers for lunches. Bring to room temperature before reheating to ensure even warming. Use microwave safe containers for quick reheating at work, covering loosely to retain moisture.

There is a quiet satisfaction in returning to a warm pot of honey mustard chicken that has been slowly developing flavor all day. It is approachable, forgiving, and endlessly adaptable. Serve it, share it, and make it your go to for busy nights that deserve a little bit of comfort.

Pro Tips

  • For best results, bring refrigerated chicken close to room temperature before cooking to help it cook evenly.

  • If sauce is too thin at the end, add the potato starch slurry in small increments and stir until desired thickness is reached.

  • Finish under a hot broiler for two to three minutes after thickening to get a slightly caramelized top if desired.

  • Marinate the chicken overnight for deeper flavor penetration and quicker service on busy days.

This nourishing slow cooker honey mustard chicken recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Southern Comfort Foodsslow-cookerchickenhoney-mustardrecipedinnerweeknightfamily-friendly
No ratings yet

Slow Cooker Honey Mustard Chicken

This Slow Cooker Honey Mustard Chicken recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 6 steaks
Slow Cooker Honey Mustard Chicken
Prep:15 minutes
Cook:4 hours
Rest Time:10 mins
Total:4 hours 15 minutes

Ingredients

Chicken

Sauce

Optional

Instructions

1

Prepare the slow cooker

Coat the slow cooker insert with non stick spray or a small amount of oil to ease cleanup and prevent sticking.

2

Mix the sauce

Combine Dijon, stone ground mustard, honey, minced garlic, salt and pepper directly in the slow cooker and stir until well blended.

3

Add the chicken

Place the breasts and thighs into the sauce and gently toss to coat each piece evenly, ensuring good contact with the mixture.

4

Optional marinating

For deeper flavor, transfer coated chicken to a zip top bag and refrigerate for a few hours or overnight, then return to the slow cooker to cook.

5

Cook the chicken

Cook on low for four to six hours or on high for two and a half to three hours until the chicken is tender and an instant read thermometer reads 165 degrees Fahrenheit.

6

Thicken the sauce

Whisk two tablespoons potato starch with four tablespoons cold water and stir into the warm sauce, allowing it to thicken into a glossy glaze before serving.

7

Serve

Spoon sauce over the chicken and serve with rice, mashed potatoes or a green salad. Garnish with chopped parsley or sliced green onions.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 420kcal | Carbohydrates: 28g | Protein:
36g | Fat: 18g | Saturated Fat: 5g |
Polyunsaturated Fat: 4g | Monounsaturated Fat:
7g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@whiskia on social media!

Slow Cooker Honey Mustard Chicken

Categories:

Slow Cooker Honey Mustard Chicken

Did You Make This?

Leave a comment & rating below or tag @whiskia on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Victoria!

Chef and recipe creator specializing in delicious Southern Comfort Foods cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.