Sweet & Easy Cinnamon French Toast Bites: A Morning Favorite
30-MINUTE MEALS! Get the email series now
Royal Recipe

Sweet & Easy Cinnamon French Toast Bites

5 from 1 vote
1 Comments
Victoria
By: VictoriaUpdated: Jul 17, 2026
This post may contain affiliate links. Please read our disclosure policy.

Crispy, tender French toast cubes tossed in warm cinnamon sugar—perfect for quick breakfasts, brunches, or a cozy weekend treat.

Sweet & Easy Cinnamon French Toast Bites

This recipe for sweet, cinnamon-kissed French toast bites has been my go-to morning treat when I want something both comforting and quick. I first discovered the idea during a hectic holiday weekend when I had a loaf of slightly stale brioche and a kitchen full of sleepy family members. Turning the bread into small, golden bites meant everyone could graze and grab a warm, crunchy mouthful without waiting for slices to cool. The balance of a soft custard interior and a crisp exterior, with the bright snap of cinnamon sugar, makes these bites impossible to resist.

I love how adaptable the method is: whether you use challah, brioche, or even day-old French bread, the result is reliably tender inside and lusciously caramelized outside. The process is fast—under 25 minutes from start to finish—and it scales easily if you’re feeding a crowd. Serve them with maple syrup, a dusting of powdered sugar, fresh berries, or a dollop of whipped cream for an indulgent weekend breakfast or a playful brunch finger food that disappears almost as quickly as you make it.

Why You'll Love This Recipe

  • Ready quickly: from mixing to plate in about 20 minutes, ideal for busy mornings or last-minute brunches.
  • Uses pantry and fridge staples: eggs, milk, bread, and a few spices—no need for specialty items.
  • Crowd-pleasing: bite-sized pieces are perfect for casual gatherings and are easy for kids to eat.
  • Flexible: works with brioche, challah, or day-old French bread and adapts to dietary swaps.
  • Make-ahead advantage: custard-soaked cubes can be refrigerated briefly or cooked straight away; cooked bites freeze well for quick reheats.
  • Textural delight: soft, custardy centers contrast with a crisp, cinnamon-sugared exterior for a perfect bite.

My family’s reaction the first time I served these was immediate: silent, satisfied eating followed by a unanimous request for seconds. Over the years I learned small adjustments—slightly less milk for older, denser loaves and using a mix of butter and a neutral oil for even browning—that elevate the texture and flavor without adding fuss.

Ingredients

  • Bread (4 cups cubed): Day-old brioche, challah, or French bread is best. Slightly dry bread soaks custard without falling apart. I often use a store-brand brioche loaf or an artisan challah when I can find one.
  • Eggs (3 large): Provide structure and richness. Use large eggs at room temperature for smoother custard and quicker absorption.
  • Milk (1/2 cup): Whole milk gives the richest flavor; 2% works well if you want lighter bites. Avoid skim for a thinner custard.
  • Vanilla extract (1 tsp): Adds warm aromatics—pure vanilla gives a more pronounced, natural sweetness than imitation.
  • Ground cinnamon (1 tsp): Divided between the custard and the coating to layer flavor.
  • Sugar (2 tbsp for custard + 1/4 cup for coating): Granulated sugar in the custard lends a subtle sweetness; the coating sugar caramelizes for crunch.
  • Salt (pinch): Enhances all flavors and keeps the sweetness from tasting flat.
  • Butter (2 tbsp for cooking): Clarified butter or a mix of butter and a neutral oil helps prevent burning while delivering flavor.
  • Optional garnishes: Powdered sugar, real maple syrup, fresh berries, or whipped cream—choose one or combine for contrast.

Instructions

Make the custard: In a shallow bowl large enough to hold the bread cubes, whisk together 3 large eggs, 1/2 cup whole milk, 1 teaspoon vanilla, 1 teaspoon ground cinnamon, 2 tablespoons sugar, and a pinch of salt until the mixture is smooth and slightly frothy. Whisking incorporates air, which makes the interior tender; let the mixture sit for a minute so the cinnamon hydrates and releases aroma. Soak the bread: Add 4 cups cubed bread to the custard and toss gently so every cube is coated. Allow the cubes to rest for 2–3 minutes to absorb the custard—longer for very dry bread, but avoid over-soaking which causes the pieces to become mushy. You want them saturated but intact. Heat the skillet: Warm a heavy-bottomed skillet over medium heat and add 2 tablespoons butter (or 1 tbsp butter + 1 tbsp neutral oil). The fat should shimmer but not smoke; this combination gives a golden crust and reduces butter burn. Cook the bites: Place soaked cubes in a single layer (work in batches to avoid crowding). Cook for about 2–3 minutes per side until golden brown and crisp, using a spatula to turn pieces carefully. Visual cues: deep golden edges and a slightly springy interior. If the pan browns too quickly, lower the heat. Prepare the coating: In a small bowl, combine 1/4 cup granulated sugar with 1 teaspoon ground cinnamon. While the bites are still warm, transfer them to a plate and toss in the cinnamon sugar so crystals adhere and slightly melt into the hot surface. Serve immediately: Arrange on a platter and dust with powdered sugar or serve with maple syrup, whipped cream, and berries. These are at their best straight from the pan when the contrast between crisp exterior and tender inside is most pronounced. User provided content image 1

You Must Know

  • These bites store well in the refrigerator for up to 2 days; reheat in a warm oven or toaster oven to restore crispness (350°F for 6–8 minutes).
  • Freezing: cooked bites freeze in a single layer then bagged for up to 3 months; reheat from frozen in a 375°F oven for 8–12 minutes.
  • High in quick energy: each serving is carbohydrate-forward from the bread and sugar—great for a filling morning boost.
  • Short prep time: active prep is under 10 minutes, cook time depends on batches but typically totals 10–12 minutes.
  • Use day-old bread: slightly stale bread soaks evenly and produces a custardy interior without falling apart.

My favorite aspect is how forgiving the method is: I’ve made these with leftover croissants for decadence, with whole-grain bread for a hearty twist, and even in a sheet-pan format for serving a crowd. Friends always tell me they prefer these bite-sized pieces to regular slices because they get more flavor and texture in every mouthful.

User provided content image 2

Storage Tips

Cool cooked bites completely before storing to avoid soggy sugar. For short-term storage, place in an airtight container in the refrigerator for up to 48 hours. To retain best texture, separate layers with parchment paper and reheat in a preheated 350°F oven for 6–8 minutes. For longer storage, freeze in a single layer on a baking sheet until firm, then transfer to a resealable bag for up to 3 months. Reheat from frozen at 375°F for 8–12 minutes, flipping halfway to crisp both sides.

Ingredient Substitutions

If you need dairy-free options, replace milk with unsweetened almond or oat milk and use a vegan butter or neutral oil for cooking. For an egg-free version, whisk 3/4 cup aquafaba with 1 tbsp cornstarch and 1 tbsp maple syrup as a loose custard—absorption will differ, so soak briefly. Whole-grain or sourdough loaves add tang and structure but reduce sweetness; increase sugar in the coating slightly to compensate. For a richer bite, swap half the milk for heavy cream.

Serving Suggestions

Serve the bites piled on a platter with small bowls of maple syrup, whipped cream, and fresh berries for self-serve brunch. For a savory contrast, pair with bacon or sausage and a citrusy fruit salad to cut the richness. For a dessert-style presentation, drizzle warm caramel and top with toasted nuts. Garnish with orange zest to brighten flavors or a sprinkle of flaky sea salt for depth.

Cultural Background

French toast, in its many forms, dates back to antiquity as a thrifty way to use stale bread across Europe. The bite-sized adaptation taps into modern casual serving styles—similar to churros or coated donut holes—and echoes the tradition of tossing warm breads in spiced sugar common to many cuisines. The cinnamon sugar finish draws on flavors beloved in American and European breakfasts, marrying the comfort of custard-soaked bread with the caramelized crunch of sugared coating.

Seasonal Adaptations

In autumn, add a pinch of ground nutmeg and swap half the sugar for maple sugar to amplify fall spices. In winter, serve with poached pears and a drizzle of warm spiced syrup. Spring and summer call for bright toppings: macerated berries, lemon curd, or a dollop of mascarpone and seasonal stone fruit. For holiday brunches, fold a tablespoon of orange liqueur into the custard for a festive lift.

Meal Prep Tips

For make-ahead mornings, cube and refrigerate bread and pre-mix the custard in a sealed container for up to 8 hours. Soak the bread just before cooking to prevent sogginess. Alternatively, assemble and cook bites the night before and reheat in the oven in the morning. Use portioned silicone muffin cups to hold individual servings when traveling or for packed brunch boxes—stack with parchment between layers.

These cinnamon French toast bites are a small, joyful way to begin a day or feed a crowd without the fuss. They reward simple technique with comforting results—crisp, sweet, and easy to customize. Try them once and they’ll quickly become a staple in your weekend morning rotation.

Pro Tips

  • Use day-old brioche or challah for the best texture; slightly stale bread absorbs custard without falling apart.

  • Cook in batches and keep finished bites warm on a low oven rack to maintain crispness.

  • If the skillet browns too fast, lower the heat and add a touch more butter or oil to prevent burning.

  • For extra-crispy bites, roll briefly in the cinnamon sugar twice—once immediately and once after resting a minute.

This nourishing sweet & easy cinnamon french toast bites recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Breakfastbreakfastrecipeseasyfamily-friendlybrunchdessert-for-breakfast
No ratings yet

Sweet & Easy Cinnamon French Toast Bites

This Sweet & Easy Cinnamon French Toast Bites recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Sweet & Easy Cinnamon French Toast Bites
Prep:10 minutes
Cook:10 minutes
Rest Time:10 mins
Total:20 minutes

Ingredients

French Toast Bites

Cinnamon Sugar Coating

Instructions

1

Make the custard

Whisk 3 large eggs, 1/2 cup milk, 1 teaspoon vanilla extract, 1 teaspoon ground cinnamon, 2 tablespoons sugar, and a pinch of salt in a shallow bowl until smooth and slightly frothy.

2

Soak the bread

Add 4 cups cubed bread and toss to coat. Let sit 2–3 minutes so the cubes absorb the custard but remain intact; adjust time for drier loaves.

3

Heat the skillet

Heat a heavy skillet over medium heat and melt 2 tablespoons butter (or 1 tbsp butter + 1 tbsp neutral oil) until foaming lightly but not smoking.

4

Cook the bites

Place soaked cubes in a single layer and cook 2–3 minutes per side until deeply golden and crisp. Work in batches to avoid crowding; lower heat if browning too quickly.

5

Prepare the coating and serve

Combine 1/4 cup granulated sugar with 1 teaspoon ground cinnamon. Toss warm cooked bites in the mixture so sugar adheres, then serve immediately with desired toppings.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 360kcal | Carbohydrates: 48g | Protein:
9g | Fat: 12g | Saturated Fat: 4g |
Polyunsaturated Fat: 2g | Monounsaturated Fat:
5g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@whiskia on social media!

Sweet & Easy Cinnamon French Toast Bites

Categories:

Sweet & Easy Cinnamon French Toast Bites

Did You Make This?

Leave a comment & rating below or tag @whiskia on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Victoria!

Chef and recipe creator specializing in delicious Breakfast cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.